Bu içerik Onedio üyesi kullanıcı tarafından üretilmiş, Onedio editör ekibi tarafından müdahale edilmemiştir. Siz de Onedio’da dilediğiniz şekilde içerik üretebilirsiniz.

Pasta Börek İkram Etmekten Sıkılanlar İçin Ev Partisi Tadında 14 Farklı Atıştırmalık

İlginç-
4 dakikada okuyabilirsiniz

Ev toplantılarının baş tacı çay, kek, börek menülerini hepimiz çok severiz. Fakat biraz değişiklik yapmaya ne dersiniz? Sizin için ev partisi tadında, minik atıştırmalıklardan, pratik lezzetlerden oluşan şarap ve kokteyller ile uyum içinde olacak 14 farklı seçenek hazırladım. Bu seçenekleri damak tadınıza göre çeşitlendirip kendi menünüzü oluşturabilirsiniz. 🍢🍷🍡🍻

1. Klasik peynir tabakları açık büfelerin, kokteyllerin vazgeçilmezidir ama klasik akşam yemeklerinin de en güzel başlangıcıdır.

2-3 peynir seçeneği, incir, üzüm ve kuruyemiş ile tabağınızı tamamlayabilirsiniz. İsterseniz kuruyemişlerin ve meyvelerin altına renkli servis kağıtları kullanabilirsiniz.

2. Bazı şeyler vardır ki, onları anlatmak için fazla söze gerek yoktur. Sadece seyretmek ve yemek istersiniz.

Hem meyve hem tatlı için renkli atıştırmalıklar hazırlayabilirsiniz. Portakal ve elmaları dilimleyip, 15 dakika fırınlayın. Meyveleri erittiğiniz çikolataya bulayıp, buzdolabında donmasını bekleyin. Renkli şekerler ile de süsleyebilirsiniz.

3. Tam buğday makarnaları renklendirelim.

Tam buğday makarnası, beyaz makarnadan daha sağlıklıdır. Çünkü, lif açısından daha zengindir ve daha çok proteine sahiptir. Ayrıca, bünyesinde daha fazla vitamin ve mineral barındırır.

Al dante haşladığınız makarnanıza kuru domates, sosis, arzuya göre peynir, kurutulmuş domates ve teze fesleğen ekleyin.Üzerine tabi ki sızma zeytinyağı ekleyip servis edin.

4. Peynir etiketi kullanarak masanızın havasını değiştirebilirsiniz.

Peynir etiketi kullanarak masanızın havasını değiştirebilirsiniz.
Peynir etiketi kullanarak masanızın havasını değiştirebilirsiniz.

Sunum tahtası yada servis tabağı kullanmak istemeyenler, minik kavanozlar yada ayaklı servis tabaklarını tercih edebilirler. Peynir isimlikleri yada etiketlerine ise misafirleriniz bayılacak.

5. Evde patates cipsi yapmaya başladığımdan beri marketten cips almak pek keyifli gelmiyor. Tarifi o kadar pratik ki arkadaşlarınız gelmeden yarım saat önce kolayca hazırlayabilirsiniz.

Patatesleri  elma dilim yada cips şeklinde keserek zeytinyağı ve baharatlar ile marine edip fırınlayın. Krem peyniri süt ile çırpın. Kıvamı katı gelirse 1-2 yemek kaşığı süt ekleyin. 1 diş sarımsak ve karabiber ekleyin.

6. En pratiğinden közlenmiş biberli peynir topları

Közlenmiş biberin köz sürecinden sonra ayıklanması vakit gerektirir, uğraşamayız derseniz çok önerilmese bile hazır közlenmiş biberleri kullanabilirsiniz. Peynir toplarına köz biberleri sararak, şirin kürdanlar ile servis edebilirsiniz.

7. Kraker tabakları

Katlı servis tabaklarını kullanarak kraker, peynir, renkli meyvelerden oluşan bir sunum hazırlayabilirsiniz.

8. Domates ve peynirleri şık bir tabak yada porselen ile de sunabilirsiniz ama çöp şiş ile yaratıcılıkta sınır yok.

Ispanaklı yada pesto soslu tortellini, peynir ve cherry domatesler ile lezzetli çöp şişler hazırlayabilirsiniz.

9. Minik, tadımlık sandviçler hazırlayalım.

Tost ekmeklerini farklı kalıplarda keserek, damak zevkinize göre ekmeklerin üzerine köri sos sürüp, tavuk ve yeşillikler ekleyebilirsiniz.

Diğer kanepeler için krem peynirli ve meyveli minik ikramlıklar hazırlayabilirsiniz.

10. Klasik salatalar yerine protein salatasına ne dersiniz?

Geniş salata kaseleri kullanmak yerine, sunum tahtası yada düz bir servise ıspanak ve rokalardan yatak oluşturun. 

Ton balığı, yumurta, domates, çeşitli zeytinler ve yeşil soğanı yeşilliklerin üzerine ekleyin. Salata sosu eklemeyi unutmayın.

11. Fransız bagetleri zengin içeriği ile hem kahvaltılık hem de öğün yemeklerinin yanında yenilebilen, günlük olarakta tercih edilebilecek ekmeklerdendir.

Yumuşak bir peynir yada baharatlı tereyağ ile baget ekmeklerini dilimleyerek servis tahtanızda sunabilirsiniz.

12. Milföy hamurundan, barbekü soslu şipşak börek ile gecenin sonunda doymayan kalmasın.

Tavuk butları zeytinyağı, taze soğan ve baharatlar ile pişirin. Milföy hamurunu ortadan ikiye kesin, içine tavuklu harcı koyup kapatın.Üzeri kızarana kadar pişen börekleri, fırından çıkınca barbekü sos ile süsleyin. Arzu ederseniz servis tabağına da barbekü ve acı sos ekleyerek servis edebilirsiniz.

13. Aperatiflerin yıldızı kanepeler minik olmak zorunda değil.

Minik kanepeler biliyorum hiç doyurucu değil. Çeşit çeşit doyurucu aperatifler hazırlayabiliriz. 

Dilimlediğiniz ekmekleri fırında kızartın, üzerine krem peynir sürüp şeftali, avakado ve incir ekleyebilirsiniz. Salatalıkları soyacak ile dilimleyip üzerine mısır ekleyebilirsiniz.

Baharatlarla tatlandırdığınız mayonez veya hardal ile balıkları servis edebilirsiniz.

14. Şirin parti tavukları

Tavuk gögsü dilimleyip baharatlar ve zeytinyağı ile harmanlayın. Tavada renkleri değişene kadar pişirin. Dilim pastırma yada jambona sarın, çöp şiş yada farklı parti çubukları ile sabitleyip fırınlayabilirsiniz.

ONEDİO YEMEK SUNAR!

Bu içerik Onedio üyesi kullanıcı tarafından üretilmiş, Onedio editör ekibi tarafından müdahale edilmemiştir. Siz de Onedio’da dilediğiniz şekilde içerik üretebilirsiniz.

BU İÇERİĞE EMOJİYLE TEPKİ VER!
Helal olsun!
Hoş değil!
Yerim!
Çok acı...
Yok artık!
Çok iyi!
Yummy

FACEBOOK YORUMLARI

ONEDİO ÜYELERİ NE DİYOR?

Yorum Yazın
zuhal-unal

cok güzel sunumlar mutfak sanatına hayran olduğumu bir kez daha anladım:)

lotkkk

#2 ne dandiktir ya, portakalın kabuğunu mu yiyeceğiz? çikolataya da batırdı, istesen de ayıramazsın artık.

zuhal-unal

tespit gibi tespit:)

lale-sagit

harika

ozlemguler

teşekkürler :)

cakma-trakyali

amannn kim uğraşacak zaten gelende yemiyor ayyy diyetteyim diye sen gömülüyosun bunlara sonra niye kilo alıyorum

janset-cataltug

insan 1,2 ve 7 yi ultra elit arkadaşlarına bile yapamaz o derece kıytırık:) ama digerlerini begendim

Başlıklar

MısırŞarapTercihçaykekmarinemeyvepastatarifitatlıyumurta
Görüş Bildir